PDB entry 5ihs

View 5ihs on RCSB PDB site
Description: Structure of CHU_2103 from Cytophaga hutchinsonii
Class: hydrolase
Keywords: Endoglucanase, TIM barrel, HYDROLASE
Deposited on 2016-02-29, released 2016-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase, glycoside hydrolase family 5 protein
    Species: Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) [TaxId:269798]
    Gene: cel, CHU_2103
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ihsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ihsA (A:)
    gmikkisvvlvlltgmllsasvfaqktivekygklsvkgnymvgqygdtvqlrgmslfws
    qwmgqyynsdvvkwlrddwkctvvraamgvemdgylenpdtekmkvmevvnaaiakgiyv
    iidyhsheaqknpaaaqrffsemakkygnipniiyevyneplqatswnkdikpyaegvit
    kirvydttniivvgtrqwsqlvteaaanpitrqnimytlhfypgthkqelrneaqkaldm
    gialfvteygtcdasgngnfspeetalwyefldahkisycnwsiadkpetasaivpaasp
    yggwadydltpsgklvrddlrlkngpifdslvktstggvskkksktk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihsA (A:)
    ktivekygklsvkgnymvgqygdtvqlrgmslfwsqwmgqyynsdvvkwlrddwkctvvr
    aamgvemdgylenpdtekmkvmevvnaaiakgiyviidyhsheaqknpaaaqrffsemak
    kygnipniiyevyneplqatswnkdikpyaegvitkirvydttniivvgtrqwsqlvtea
    aanpitrqnimytlhfypgthkqelrneaqkaldmgialfvteygtcdasgngnfspeet
    alwyefldahkisycnwsiadkpetasaivpaaspyggwadydltpsgklvrddlrlkng
    pifdsl