PDB entry 5ihr

View 5ihr on RCSB PDB site
Description: structure of e298q-beta-galactosidase from aspergillus niger in complex with allolactose
Class: hydrolase
Keywords: TIM barrel, GH35, GLYCOSIDE HYDROLASE, KINETICS, PROTEIN CONFORMATION, carbohydrate metabolism, b-galactosidase, Aspergillus niger, fungal protein, SUBSTRATE SPECIFICITY, prebiotics, galactooligosaccharides, GOS, recombinant, allolactose, b-D-galactopyranosyl-(1-6)-D-glucopyranose, HYDROLASE
Deposited on 2016-02-29, released 2017-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable beta-galactosidase A
    Species: Aspergillus niger CBS 513.88 [TaxId:425011]
    Gene: lacA, An01g12150
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2QAN3 (Start-1006)
      • engineered mutation (297)
      • expression tag (1007)
    Domains in SCOPe 2.06: d5ihra1, d5ihra2, d5ihra3, d5ihra4, d5ihra5, d5ihra6
  • Heterogens: NAG, BMA, MAN, SO4, CL, DMS, GAL, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ihrA (A:)
    mklssacaiallaaqaagasikhringftltehsdpakrellqkyvtwddkslfingeri
    mifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwalvegkpgeyradgifdlepf
    fdaaseagiyllarpgpyinaessgggfpgwlqrvngtlrssdkayldatdnyvshvaat
    iakyqitnggpiilyqpeneytsgccgvefpdpvymqyvedqarnagvviplinndasas
    gnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptnfrtlhleqspttpyaivqfq
    ggsydpwggpgfaacsellnnefervfykndfsfqiaimnlymifggtnwgnlgypngyt
    sydygsavtesrnitrekyselkllgnfakvspgyltaspgnlttsgyadttdltvtpll
    gnstgsffvvrhsdysseestsyklrlptsagsvtipqlggtltlngrdskihvtdynvs
    gtniiystaevftwkkfadgkvlvlyggagehhelaistksnvtviegsesgisskqtss
    svvvgwdvsttrriiqvgdlkillldrnsaynywvpqlatdgtspgfstpekvassiivk
    agylvrtaylkgsglyltadfnattsvevigvpstaknlfingdktshtvdkngiwsatv
    dynapdislpslkdldwkyvdtlpeiqssyddslwpaadlkqtkntlrslttptslyssd
    ygfhtgyllyrghftatgnestfaidtqggsafgssvwlngtylgswtglyansdynaty
    nlpqlqagktyvitvvidnmgleenwtvgedlmktprgilnfllagrpssaiswkltgnl
    ggedyedkvrgplnegglyaerqgfhqpeppsqnwkssspleglseagigfysasfdldl
    pkgwdvplflnignsttpspyrvqvyvngyqyakyisnigpqtsfpvpegilnyrgtnwl
    avtlwaldsaggkleslelsyttpvltalgevesvdqpkykkrkgayhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ihrA (A:)
    llqkyvtwddkslfingerimifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwa
    lvegkpgeyradgifdlepffdaaseagiyllarpgpyinaessgggfpgwlqrvngtlr
    ssdkayldatdnyvshvaatiakyqitnggpiilyqpeneytsgccgvefpdpvymqyve
    dqarnagvviplinndasasgnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptn
    frtlhleqspttpyaivqfqggsydpwggpgfaacsellnnefervfykndfsfqiaimn
    lymifggtnwgnlgypngytsydygsavtesrnitrekyselkllgnfakvspgyltasp
    gnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsagsvtipqlg
    gtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehhelaistk
    snvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillldrnsaynywvpqlat
    dgtspgfstpekvassiivkagylvrtaylkgsglyltadfnattsvevigvpstaknlf
    ingdktshtvdkngiwsatvdynapdislpslkdldwkyvdtlpeiqssyddslwpaadl
    kqtkntlrslttptslyssdygfhtgyllyrghftatgnestfaidtqggsafgssvwln
    gtylgswtglyansdynatynlpqlqagktyvitvvidnmgleenwtvgedlmktprgil
    nfllagrpssaiswkltgnlggedyedkvrgplnegglyaerqgfhqpeppsqnwksssp
    leglseagigfysasfdldlpkgwdvplflnignsttpspyrvqvyvngyqyakyisnig
    pqtsfpvpegilnyrgtnwlavtlwaldsaggkleslelsyttpvltalgevesvdqpky
    kkrkgayh