PDB entry 5ihn

View 5ihn on RCSB PDB site
Description: Crystal Structure of the alpha spectrin SH3 domain mutant N47G
Class: structural protein
Keywords: SH3-like barrel, structural protein
Deposited on 2016-02-29, released 2017-03-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: spectrin alpha chain, non-erythrocytic 1
  Species: Gallus gallus [TaxId:9031]
  Gene: SPTAN1, SPTA2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07751
    • engineered mutation (46)
  Domains in SCOPe 2.06: d5ihna_
• Heterogens: FMT, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5ihnA (A:)
  mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevgdrqgfvpaayvkk
  ld
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5ihnA (A:)
  kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevgdrqgfvpaayvkkl