PDB entry 5ih7

View 5ih7 on RCSB PDB site
Description: Acetylcholinesterase of Torpedo californica in complex with the N-methyl-indoxylacetate hydrolysis products
Class: hydrolase
Keywords: Acetylcholinesterase NMIA, hydrolase
Deposited on 2016-02-29, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ih7a_
  • Heterogens: NAG, OMI, PG4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ih7A (A:)
    dhsellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnas
    typnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfy
    sgsstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvh
    dniqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaeg
    rrravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeff
    ptslesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvp
    handlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtyly
    ffnhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgn
    pnephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat