PDB entry 5ifp

View 5ifp on RCSB PDB site
Description: structure of beta-galactosidase from aspergillus niger
Class: hydrolase
Keywords: TIM barrel, GH35, GLYCOSIDE HYDROLASE, KINETICS, PROTEIN CONFORMATION, carbohydrate metabolism, b-galactosidase, Aspergillus niger, fungal protein, SUBSTRATE SPECIFICITY, prebiotics, galactooligosaccharides, GOS, native, wildtype, HYDROLASE
Deposited on 2016-02-26, released 2017-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-galactosidase A
    Species: Aspergillus niger CBS 513.88 [TaxId:425011]
    Gene: lacA, An01g12150
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2QAN3 (Start-1006)
      • expression tag (1007)
    Domains in SCOPe 2.06: d5ifpa1, d5ifpa2, d5ifpa3, d5ifpa4, d5ifpa5, d5ifpa6
  • Heterogens: NAG, BMA, MAN, SO4, CL, BTB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ifpA (A:)
    mklssacaiallaaqaagasikhringftltehsdpakrellqkyvtwddkslfingeri
    mifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwalvegkpgeyradgifdlepf
    fdaaseagiyllarpgpyinaessgggfpgwlqrvngtlrssdkayldatdnyvshvaat
    iakyqitnggpiilyqpeneytsgccgvefpdpvymqyvedqarnagvviplinndasas
    gnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptnfrtlhleqspttpyaivefq
    ggsydpwggpgfaacsellnnefervfykndfsfqiaimnlymifggtnwgnlgypngyt
    sydygsavtesrnitrekyselkllgnfakvspgyltaspgnlttsgyadttdltvtpll
    gnstgsffvvrhsdysseestsyklrlptsagsvtipqlggtltlngrdskihvtdynvs
    gtniiystaevftwkkfadgkvlvlyggagehhelaistksnvtviegsesgisskqtss
    svvvgwdvsttrriiqvgdlkillldrnsaynywvpqlatdgtspgfstpekvassiivk
    agylvrtaylkgsglyltadfnattsvevigvpstaknlfingdktshtvdkngiwsatv
    dynapdislpslkdldwkyvdtlpeiqssyddslwpaadlkqtkntlrslttptslyssd
    ygfhtgyllyrghftatgnestfaidtqggsafgssvwlngtylgswtglyansdynaty
    nlpqlqagktyvitvvidnmgleenwtvgedlmktprgilnfllagrpssaiswkltgnl
    ggedyedkvrgplnegglyaerqgfhqpeppsqnwkssspleglseagigfysasfdldl
    pkgwdvplflnignsttpspyrvqvyvngyqyakyisnigpqtsfpvpegilnyrgtnwl
    avtlwaldsaggkleslelsyttpvltalgevesvdqpkykkrkgayhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ifpA (A:)
    llqkyvtwddkslfingerimifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwa
    lvegkpgeyradgifdlepffdaaseagiyllarpgpyinaessgggfpgwlqrvngtlr
    ssdkayldatdnyvshvaatiakyqitnggpiilyqpeneytsgccgvefpdpvymqyve
    dqarnagvviplinndasasgnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptn
    frtlhleqspttpyaivefqggsydpwggpgfaacsellnnefervfykndfsfqiaimn
    lymifggtnwgnlgypngytsydygsavtesrnitrekyselkllgnfakvspgyltasp
    gnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsagsvtipqlg
    gtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehhelaistk
    snvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillldrnsaynywvpqlat
    dgtspgfstpekvassiivkagylvrtaylkgsglyltadfnattsvevigvpstaknlf
    ingdktshtvdkngiwsatvdynapdislpslkdldwkyvdtlpeiqssyddslwpaadl
    kqtkntlrslttptslyssdygfhtgyllyrghftatgnestfaidtqggsafgssvwln
    gtylgswtglyansdynatynlpqlqagktyvitvvidnmgleenwtvgedlmktprgil
    nfllagrpssaiswkltgnlggedyedkvrgplnegglyaerqgfhqpeppsqnwksssp
    leglseagigfysasfdldlpkgwdvplflnignsttpspyrvqvyvngyqyakyisnig
    pqtsfpvpegilnyrgtnwlavtlwaldsaggkleslelsyttpvltalgevesvdqpky
    kkrkgayh