PDB entry 5ifl

View 5ifl on RCSB PDB site
Description: Crystal structure of B. pseudomallei FabI in complex with NAD and triclosan
Class: oxidoreductase
Keywords: enoyl-ACP reductase, Burkholderia pseudomallei, diphenyl ethers, slow-binding inhibitors, oxidoreductase
Deposited on 2016-02-26, released 2017-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifla_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflc_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifld_
  • Chain 'E':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifle_
  • Chain 'F':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflf_
  • Chain 'G':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflg_
  • Chain 'H':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflh_
  • Chain 'I':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifli_
  • Chain 'J':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflj_
  • Chain 'K':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflk_
  • Chain 'L':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifll_
  • Chain 'M':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflm_
  • Chain 'N':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifln_
  • Chain 'O':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflo_
  • Chain 'P':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5iflp_
  • Heterogens: TCL, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iflA (A:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflA (A:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iflB (B:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflB (B:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iflC (C:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflC (C:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5iflD (D:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflD (D:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5iflE (E:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflE (E:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5iflF (F:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflF (F:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5iflG (G:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflG (G:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5iflH (H:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflH (H:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5iflI (I:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflI (I:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5iflJ (J:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflJ (J:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5iflK (K:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflK (K:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5iflL (L:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflL (L:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5iflM (M:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflM (M:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5iflN (N:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflN (N:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5iflO (O:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflO (O:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5iflP (P:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iflP (P:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg