PDB entry 5ifk

View 5ifk on RCSB PDB site
Description: Purine nucleoside phosphorylase
Class: transferase
Keywords: Purine nucleoside phosphorylase Hypoxanthine NP-I family Kluyveromyces lactis, TRANSFERASE
Deposited on 2016-02-26, released 2017-03-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Gene: KLLA0_C16621g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifka_
  • Chain 'B':
    Compound: purine nucleoside phosphorylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Gene: KLLA0_C16621g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifkb_
  • Chain 'C':
    Compound: purine nucleoside phosphorylase
    Species: Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) [TaxId:284590]
    Gene: KLLA0_C16621g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifkc_
  • Heterogens: HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ifkA (A:)
    mssldineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplil
    systipgfkvstvpghsgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgs
    invlivtnaagginasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdayd
    lelrkllfskkkelnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvt
    arhcgwrvlalslitnecvvdppasahdenpvpiqegkatheevlensakaskdvqelif
    svvaeihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ifkA (A:)
    dineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplilsyst
    ipgfkvgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgsinvlivtnaag
    ginasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdaydlelrkllfskk
    kelnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvtarhcgwrvlal
    slitnecvvdppasahdenpvpiqegkatheevlensakaskdvqelifsvvaei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ifkB (B:)
    mssldineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplil
    systipgfkvstvpghsgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgs
    invlivtnaagginasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdayd
    lelrkllfskkkelnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvt
    arhcgwrvlalslitnecvvdppasahdenpvpiqegkatheevlensakaskdvqelif
    svvaeihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ifkB (B:)
    dineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplilsyst
    ipgfgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgsinvlivtnaaggi
    nasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdaydlelrkllfskkke
    lnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvtarhcgwrvlalsl
    itnecvvdppasahdenpvpiqegkatheevlensakaskdvqelifsvvaei
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ifkC (C:)
    mssldineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplil
    systipgfkvstvpghsgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgs
    invlivtnaagginasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdayd
    lelrkllfskkkelnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvt
    arhcgwrvlalslitnecvvdppasahdenpvpiqegkatheevlensakaskdvqelif
    svvaeihhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ifkC (C:)
    ineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplilsysti
    pgfgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgsinvlivtnaaggin
    asfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdaydlelrkllfskkkel
    nierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvtarhcgwrvlalsli
    tnecvvdppasahdenpvpiqegkatheevlensakaskdvqelifsvvaei