PDB entry 5ifc

View 5ifc on RCSB PDB site
Description: Crystal structure of polymerase acid protein (PA) from Influenza A virus, WILSON-SMITH/1933 (H1N1) bound to follow on fragment EBSI-4720 1-(4-bromophenyl)-1H-imidazole
Class: viral protein
Keywords: NIAID, flu, structural genomics, fragment screening, STD NMR, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN
Deposited on 2016-02-25, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: Influenza A virus (strain A/Wilson-Smith/1933 H1N1) [TaxId:381518]
    Gene: PA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ifca_
  • Heterogens: 6AR, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ifcA (A:)
    gnariepflkstprplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmr
    tffgwkepnvvkphekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalge
    nmapekvdfddckdvgdlkqydsdepelrslaswiqnefnkaceltdsswieldeigeda
    apiehiasmrrnyftaevshcrateyimkgvyintallnascaamddfqlipmiskcrtk
    egrrktnlygfiikgrshlrndtdvvnfvsmefsltdprlephkwekycvlevgdmllrs
    aighvsrpmflyvrtngtskikmkwgmemrrcllqslqqiesmieaessvkekdmtkeff
    enksetwpvgespkgveegsigkvcrtllaksvfnslyaspqlegfsaesrklllivqal
    rdnlepgtfdlgglyeaieeclindpwvllnaswfnsflthalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ifcA (A:)
    rplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmrtffgwkepnvvkp
    hekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalgeelrslaswiqnef
    nkaceltdsswieldeigedaapiehiasmrrnyftaevshcrateyimkgvyintalln
    ascaamddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdvvnfvsmefsltdpr
    lephkwekycvlevgdmllrsaighvsrpmflyvrtngtskikmkwgmemrrcllqslqq
    iesmieaessvkekdmtkeffenkspkgveegsigkvcrtllaksvfnslyaspqlegfs
    aesrklllivqalrdnlepggglyeaieeclindpwvllnaswfnsflth