PDB entry 5if2

View 5if2 on RCSB PDB site
Description: Crystal structure of polymerase acid protein (PA) from Influenza A virus, WILSON-SMITH/1933 (H1N1) bound to fragment hit EBSI-576 (5,6-dichloro-1H-1,3-benzodiazol-2-yl)methanol
Class: viral protein
Keywords: NIAID, structural genomics, fragment screening, STD NMR, flu, RdRp, polymerase, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN
Deposited on 2016-02-25, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: Influenza A virus (strain A/Wilson-Smith/1933 H1N1) [TaxId:381518]
    Gene: PA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5if2a_
  • Heterogens: 6B1, DMS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5if2A (A:)
    gnariepflkstprplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmr
    tffgwkepnvvkphekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalge
    nmapekvdfddckdvgdlkqydsdepelrslaswiqnefnkaceltdsswieldeigeda
    apiehiasmrrnyftaevshcrateyimkgvyintallnascaamddfqlipmiskcrtk
    egrrktnlygfiikgrshlrndtdvvnfvsmefsltdprlephkwekycvlevgdmllrs
    aighvsrpmflyvrtngtskikmkwgmemrrcllqslqqiesmieaessvkekdmtkeff
    enksetwpvgespkgveegsigkvcrtllaksvfnslyaspqlegfsaesrklllivqal
    rdnlepgtfdlgglyeaieeclindpwvllnaswfnsflthalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5if2A (A:)
    prplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmrtffgwkepnvvk
    phekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalgeelrslaswiqne
    fnkaceltdsswieldeigedaapiehiasmrrnyftaevshcrateyimkgvyintall
    nascaamddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdvvnfvsmefsltdp
    rlephkwekycvlevgdmllrsaighvsrpmflyvrtngtskikmkwgmemrrcllqslq
    qiesmieaessvkekdmtkeffenkespkgveegsigkvcrtllaksvfnslyaspqleg
    fsaesrklllivqalrdnlgglyeaieeclindpwvllnaswfnsflth