PDB entry 5idu

View 5idu on RCSB PDB site
Description: Crystal structure of an acyl-CoA dehydrogenase domain protein from Burkholderia phymatum bound to FAD
Class: oxidoreductase
Keywords: NIAID, structural genomics, FAD, tetramer, Seattle Structural Genomics Center for Infectious Disease, SSGCID, OXIDOREDUCTASE
Deposited on 2016-02-24, released 2016-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA dehydrogenase domain protein
    Species: Burkholderia phymatum [TaxId:391038]
    Gene: Bphy_4072
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idua1, d5idua2
  • Chain 'B':
    Compound: Acyl-CoA dehydrogenase domain protein
    Species: Burkholderia phymatum [TaxId:391038]
    Gene: Bphy_4072
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idub1, d5idub2
  • Chain 'C':
    Compound: Acyl-CoA dehydrogenase domain protein
    Species: Burkholderia phymatum [TaxId:391038]
    Gene: Bphy_4072
    Database cross-references and differences (RAF-indexed):
    • Uniprot B2JPK4 (10-End)
      • expression tag (1-9)
    Domains in SCOPe 2.07: d5iduc1, d5iduc2, d5iduc3
  • Chain 'D':
    Compound: Acyl-CoA dehydrogenase domain protein
    Species: Burkholderia phymatum [TaxId:391038]
    Gene: Bphy_4072
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5idud1, d5idud2
  • Heterogens: FAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5iduA (A:)
    mahhhhhhmlaanlidphgalawpffearhrelaagieawatqhlacvqhddtdttcrkl
    vralgeagwlkygvggaqygghgdtidtravcllretlanhdgladfalamqglgsgait
    lagtheqkirylprvskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisn
    ggiadfyvvfartgeapgargisafivdadtpglqiaeridviaphplarlhfdsarvpr
    sqmlgapgegfkiamrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqlt
    qtklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggm
    gvqsgttverlyreiralriyegatevqqlivgrdllkahaaqrqqeras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iduA (A:)
    idphgalawpffearhrelaagieawatqhlacvqhddtdttcrklvralgeagwlkygv
    ggaqygghgdtidtravcllretlanhdgladfalamqglgsgaitlagtheqkirylpr
    vskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisnggiadfyvvfartg
    eapgargisafivdadtpglqiaeridviaphplarlhfdsarvprsqmlgapgegfkia
    mrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqltqtklaqmaltidss
    allvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggmgvqsgttverlyre
    iralriyegatevqqlivgrdllkahaaqrqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5iduB (B:)
    mahhhhhhmlaanlidphgalawpffearhrelaagieawatqhlacvqhddtdttcrkl
    vralgeagwlkygvggaqygghgdtidtravcllretlanhdgladfalamqglgsgait
    lagtheqkirylprvskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisn
    ggiadfyvvfartgeapgargisafivdadtpglqiaeridviaphplarlhfdsarvpr
    sqmlgapgegfkiamrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqlt
    qtklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggm
    gvqsgttverlyreiralriyegatevqqlivgrdllkahaaqrqqeras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iduB (B:)
    idphgalawpffearhrelaagieawatqhlacvqhddtdttcrklvralgeagwlkygv
    ggaqygghgdtidtravcllretlanhdgladfalamqglgsgaitlagtheqkirylpr
    vskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisnggiadfyvvfartg
    eapgargisafivdadtpglqiaeridviaphplarlhfdsarvprsqmlgapgegfkia
    mrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqltqtklaqmaltidss
    allvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggmgvqsgttverlyre
    iralriyegatevqqlivgrdllkahaaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iduC (C:)
    mahhhhhhmlaanlidphgalawpffearhrelaagieawatqhlacvqhddtdttcrkl
    vralgeagwlkygvggaqygghgdtidtravcllretlanhdgladfalamqglgsgait
    lagtheqkirylprvskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisn
    ggiadfyvvfartgeapgargisafivdadtpglqiaeridviaphplarlhfdsarvpr
    sqmlgapgegfkiamrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqlt
    qtklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggm
    gvqsgttverlyreiralriyegatevqqlivgrdllkahaaqrqqeras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iduC (C:)
    ahhhhhhmlaanlidphgalawpffearhrelaagieawatqhlacvqhddtdttcrklv
    ralgeagwlkygvggaqygghgdtidtravcllretlanhdgladfalamqglgsgaitl
    agtheqkirylprvskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisng
    giadfyvvfartgeapgargisafivdadtpglqiaeridviaphplarlhfdsarvprs
    qmlgapgegfkiamrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqltq
    tklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggmg
    vqsgttverlyreiralriyegatevqqlivgrdllkahaaqrqq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5iduD (D:)
    mahhhhhhmlaanlidphgalawpffearhrelaagieawatqhlacvqhddtdttcrkl
    vralgeagwlkygvggaqygghgdtidtravcllretlanhdgladfalamqglgsgait
    lagtheqkirylprvskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisn
    ggiadfyvvfartgeapgargisafivdadtpglqiaeridviaphplarlhfdsarvpr
    sqmlgapgegfkiamrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqlt
    qtklaqmaltidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggm
    gvqsgttverlyreiralriyegatevqqlivgrdllkahaaqrqqeras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iduD (D:)
    idphgalawpffearhrelaagieawatqhlacvqhddtdttcrklvralgeagwlkygv
    ggaqygghgdtidtravcllretlanhdgladfalamqglgsgaitlagtheqkirylpr
    vskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisnggiadfyvvfartg
    eapgargisafivdadtpglqiaeridviaphplarlhfdsarvprsqmlgapgegfkia
    mrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqltqtklaqmaltidss
    allvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggmgvqsgttverlyre
    iralriyegatevqqlivgrdllkahaaqrqq