PDB entry 5icg

View 5icg on RCSB PDB site
Description: Crystal structure of apo (S)-norcoclaurine 6-O-methyltransferase
Class: transferase
Keywords: methyltransferase, benzylisoquinoline alkaloid, transferase
Deposited on 2016-02-23, released 2016-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (S)-norcoclaurine 6-O-methyltransferase
    Species: Thalictrum flavum subsp. glaucum [TaxId:150095]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5icga1, d5icga2
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5icgA (A:)
    gamvminkenlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlps
    qpvnqdalyrvlrylvhmklftkssidgelryglappakflvkgwdkcmlgailtitdkd
    fmapwhylkegilndgststafekalgtniwdymaehpeknqlfnegmandtrlimsalv
    kecssmfdgittivdvgggtgtavrniakafphikctvydlphviadspgyteinsiqgd
    mfkyipnadaimmkcilhdwddkecieilkrckdavprdggkviiidiildvksehpytk
    mrltldldmmlntggkerteeewkklihdagykgykithisavqsvieaypy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5icgA (A:)
    nlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlpsqpvnqdaly
    rvlrylvhmklftkssidgelryglappakflvkgwdkcmlgailtitdkdfmapwhylk
    egilndststafekalgtniwdymaehpeknqlfnegmandtrlimsalvkecssmfdgi
    ttivdvgggtgtavrniakafphikctvydlphviipnadaimmkcilhdwddkecieil
    krckdavprdggkviiidiildvksehpytkmrltldldmmlntggkerteeewkklihd
    agykgykithisavqsvieaypy