PDB entry 5ice

View 5ice on RCSB PDB site
Description: Crystal structure of (S)-norcoclaurine 6-O-methyltransferase with S-adenosyl-L-homocysteine and norlaudanosoline
Class: transferase
Keywords: methyltransferase, benzylisoquinoline alkaloid, transferase
Deposited on 2016-02-23, released 2016-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (S)-norcoclaurine 6-O-methyltransferase
    Species: Thalictrum flavum subsp. glaucum [TaxId:150095]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5C9L7 (4-351)
      • expression tag (0-3)
    Domains in SCOPe 2.06: d5icea1, d5icea2, d5icea3
  • Heterogens: SAH, 2H4, K, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5iceA (A:)
    gamvminkenlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlps
    qpvnqdalyrvlrylvhmklftkssidgelryglappakflvkgwdkcmlgailtitdkd
    fmapwhylkegilndgststafekalgtniwdymaehpeknqlfnegmandtrlimsalv
    kecssmfdgittivdvgggtgtavrniakafphikctvydlphviadspgyteinsiqgd
    mfkyipnadaimmkcilhdwddkecieilkrckdavprdggkviiidiildvksehpytk
    mrltldldmmlntggkerteeewkklihdagykgykithisavqsvieaypy