PDB entry 5ibn

View 5ibn on RCSB PDB site
Description: Ultra high resolution crystal structure of the apo- form of second bromodomain of BRD2.
Class: transcription
Keywords: BET-family, acetyl-lysine binding, TRANSCRIPTION
Deposited on 2016-02-22, released 2016-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: N/A
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD2, KIAA9001, RING3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25440 (3-110)
    • expression tag (0-2)
  Domains in SCOPe 2.07: d5ibna1, d5ibna2
• Heterogens: CL, GOL, PGE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ibnA (A:)
  anpeqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkme
  nrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd