PDB entry 5ibm

View 5ibm on RCSB PDB site
Description: Structure of S502P, a Cancer-Associated Mutation of the Oncogenic Phosphatase SHP2
Class: hydrolase
Keywords: TYROSINE PHOSPHATASE SHP2 S502P, Tyrosine-protein phosphatase non-receptor type 11, HYDROLASE
Deposited on 2016-02-22, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-04, with a file datestamp of 2016-04-29.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-525)
      • engineered mutation (502)
    Domains in SCOPe 2.07: d5ibma1, d5ibma2, d5ibma3
  • Chain 'B':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN11, PTP2C, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124
      • engineered mutation (502)
    Domains in SCOPe 2.07: d5ibmb1, d5ibmb2, d5ibmb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ibmA (A:)
    smtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrpgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ibmA (A:)
    rrwfhpnitgveaenllltrgvdgsflarpspgdftlsvrrngavthikiqntgdyydly
    ggekfatlaelvqyymehqlkeielkyplncadptserwfhghlsgkeaeklltekgkhg
    sflvreshpgdfvlsvrtgkskvthvmircqelkydvgggerfdsltdlvehykknpmve
    tlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqqqeckllysrkegqrqenk
    nknryknilpfdhtrvvlhdgdppvsdyinaniimpefkksyiatqgclqntvndfwrmv
    fqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklsk
    vgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigr
    tgtfividilidiirekgvdcdidvpktiqmvrsqrpgmvqteaqyrfiymavqhyietl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ibmB (B:)
    smtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqnt
    gdyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsg
    keaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelky
    dvgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaet
    tdkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpne
    pvsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttke
    vergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyh
    frtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidii
    rekgvdcdidvpktiqmvrsqrpgmvqteaqyrfiymavqhyietl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ibmB (B:)
    srrwfhpnitgveaenllltrgvdgsflarpskspgdftlsvrrngavthikiqntgdyy
    dlyggekfatlaelvqyymehqlvielkyplncadptserwfhghlsgkeaeklltekgk
    hgsflvresshpgdfvlsvrtgkskvthvmircqelkydvgggerfdsltdlvehykknp
    mvetlgtvlqlkqplnttrinaaeiesrvrelskgfweefetlqqqeckllysrkegqrq
    enknknryknilpfdhtrvvlhdgdppvsdyinaniimpepkksyiatqgclqntvndfw
    rmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelk
    lskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsag
    igrtgtfividilidiirekgvdcdidvpktiqmvrsqrpgmvqteaqyrfiymavqhyi
    et