PDB entry 5i95

View 5i95 on RCSB PDB site
Description: Crystal Structure of Human Mitochondrial Isocitrate Dehydrogenase R140Q Mutant Homodimer bound to NADPH and alpha-Ketoglutaric acid
Class: oxidoreductase
Keywords: IDH, ICD-M, IDP NADP(+)-specific ICDH Oxalosuccinate decarboxylase, aKG, alphaKG, oxo-glutarate., OXIDOREDUCTASE
Deposited on 2016-02-19, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: IDH2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48735 (Start-413)
      • engineered mutation (101)
      • expression tag (414)
    Domains in SCOPe 2.07: d5i95a1, d5i95a2
  • Heterogens: NDP, CA, GOL, ACT, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i95A (A:)
    madkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvti
    dsalatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiicknip
    rlvpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvg
    mgmyntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdf
    dknkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpd
    gktieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqml
    ekvcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrqlehhhh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i95A (A:)
    dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids
    alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl
    vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg
    myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk
    nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk
    tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek
    vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrql