PDB entry 5i89

View 5i89 on RCSB PDB site
Description: Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone G02857790
Class: protein binding/inhibitor
Keywords: bromodomain inhibitor, PROTEIN BINDING-INHIBITOR complex
Deposited on 2016-02-18, released 2016-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i89a_
  • Heterogens: ACT, CA, 69B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5i89A (A:)
gskkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstik
rkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

    Sequence, based on observed residues (ATOM records): (download) 
    >5i89A (A:)
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg