PDB entry 5i7x

View 5i7x on RCSB PDB site
Description: BRD9 in complex with Cpd2 (N,N-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro-1H-pyrrolo[2,3-c]pyridin-4-yl)benzamide)
Class: RNA binding protein
Keywords: Bromodomain Inhibitor Epigenetics Structure-based drug design, RNA BINDING PROTEIN
Deposited on 2016-02-18, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD9, UNQ3040/PRO9856
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i7xa_
  • Heterogens: 67B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5i7xA (A:)
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmms