PDB entry 5i7e

View 5i7e on RCSB PDB site
Description: Crystal structure of B. pseudomallei FabI in apo form
Class: oxidoreductase
Keywords: enoyl-ACP reductase, Burkholderia pseudomallei, oxidoreductase
Deposited on 2016-02-17, released 2017-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Burkholderia pseudomallei [TaxId:28450]
    Gene: fabI, fabI_2, ACT79_25590, AM256_11615, AM257_11635, AMS56_08605, DP46_2957, DP49_6839, ERS012314_03793, ERS012372_03823, SY87_14645, TR70_1075, VU09_13745
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i7ea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i7eA (A:)
    mgfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselv
    fpcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdis
    aysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgak
    gvrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgv
    taevmhvdsgfnavvggmagleeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i7eA (A:)
    gfldgkrilltgllsnrsiaygiakackregaelaftyvgdrfkdritefaaefgselvf
    pcdvaddaqidalfaslkthwdsldglvhsigfapreaiagdfldgltrenfriahdisa
    ysfpalakaalpmlsddaslltlsylgaeraipnyntmglakaaleasvrylavslgakg
    vrvnaisagpiktlaasgiksfgkildfvesnsplkrnvtieqvgnagafllsdlasgvt
    aevmhvdsgfnavvg