PDB entry 5i5g

View 5i5g on RCSB PDB site
Description: Crystal Structure of Transketolase mutant-R525L from Pichia Stipitis
Class: transferase
Keywords: transketolase, TRANSFERASE
Deposited on 2016-02-15, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Scheffersomyces stipitis CBS 6054 [TaxId:322104]
    Gene: TKT, TKT1, PICST_67105
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34736 (Start-696)
      • engineered mutation (544)
    Domains in SCOPe 2.07: d5i5ga1, d5i5ga2, d5i5ga3
  • Heterogens: POP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i5gA (A:)
    mgsshhhhhhssglvprgshmssvdqkaistirllavdavaaansghpgaplglapaaha
    vfkkmrfnpkdtkwinrdrfvlsnghacallysmlvlygydltvedlkkfrqlgsktpgh
    pentdvpgaevttgplgqgicngvgialaqaqfaatynkpdfpisdsytyvflgdgclme
    gvsseasslaghlqlgnliafwddnkisidgstevaftedviaryksygwhivevsdadt
    ditaiaaaideakkvtnkptlvrltttigfgslaqgthgvhgaplkaddikqlktkwgfn
    peesfavpaevtasynehvaenqkiqqqwnelfaaykqkypelgaelqrrldgklpenwd
    kalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdfqpaatg
    lgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsalsefpi
    twvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaiesthtphi
    laltlqnlpqlegssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgika
    gvvslpdqltfdkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkap
    eifklfeftpegvaeraaktvafykgkdvvsplrsaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i5gA (A:)
    ssvdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfv
    lsnghacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgic
    ngvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliaf
    wddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptl
    vrltttigfgslaqgthgvhgaplkaddikqlktkwgfnpeesfavpaevtasynehvae
    nqkiqqqwnelfaaykqkypelgaelqrrldgklpenwdkalpvytpadaavatrklsei
    vlskiipevpeiiggsadltpsnltkakgtvdfqpaatglgdysgryirygvrehamgai
    mngiaafganyknyggtflnfvsyaagavrlsalsefpitwvathdsiglgedgpthqpi
    etlahfratpnisvwrpadgnetsaayksaiesthtphilaltlqnlpqlegssiekask
    ggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltfdkqseeykls
    vlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpegvaeraaktv
    afykgkdvvsplrsaf