PDB entry 5i4v

View 5i4v on RCSB PDB site
Description: Discovery of novel, orally efficacious Liver X Receptor (LXR) beta agonists
Class: DNA binding protein
Keywords: LXRbeta-LBD, RXRbeta-LBD, heterodimer, agonist, DNA BINDING PROTEIN
Deposited on 2016-02-12, released 2016-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxysterols receptor LXR-beta,Nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, BHLHE75, SRC2, TIF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55055 (Start-250)
      • engineered mutation (48)
      • engineered mutation (50-51)
      • engineered mutation (53)
      • linker (251-256)
    • Uniprot Q15596 (257-End)
    Domains in SCOPe 2.06: d5i4va_
  • Chain 'B':
    Compound: Retinoic acid receptor RXR-beta,Nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, BHLHE75, SRC2, TIF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5i4vb1, d5i4vb2
  • Chain 'E':
    Compound: Oxysterols receptor LXR-beta,Nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, BHLHE75, SRC2, TIF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55055
      • engineered mutation (50-51)
      • engineered mutation (53)
    • Uniprot Q15596
    Domains in SCOPe 2.06: d5i4ve1
  • Chain 'F':
    Compound: Retinoic acid receptor RXR-beta,Nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA2, BHLHE75, SRC2, TIF2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28702 (Start-235)
      • linker (240-241)
    • Uniprot Q15596 (242-End)
    Domains in SCOPe 2.06: d5i4vf_
  • Heterogens: 67S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i4vA (A:)
    gshmgegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfah
    ftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitfl
    kdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepg
    rvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklp
    pllseiwdvhegsgsgshkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i4vA (A:)
    vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelaii
    svqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftysk
    ddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqq
    pyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiw
    dvhegsgsgshkilhrllqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i4vB (B:)
    mgapeempvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlve
    wakriphfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsag
    vgaifdrvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasle
    tyckqkypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleagsgs
    gshkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i4vB (B:)
    eempvdrileaelavepvtnicqaadkqlftlvewakriphfsslplddqvillragwne
    lliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktel
    gclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrs
    iglkclehlfffklipidtflmemleakilhrllq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5i4vE (E:)
    gshmgegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfah
    ftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitfl
    kdftyskddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepg
    rvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklp
    pllseiwdvhegsgsgshkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i4vE (E:)
    vqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgsasqqrfahftelaiisvqeiv
    dfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhra
    glqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveal
    lsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdvkilh
    rllqd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5i4vF (F:)
    mgapeempvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlve
    wakriphfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsag
    vgaifdrvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasle
    tyckqkypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleagsgs
    gshkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i4vF (F:)
    eempvdrileaelavepvtnicqaadkqlftlvewakriphfsslplddqvillragwne
    lliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktel
    gclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrs
    iglkclehlfffkligdtflmemleagshkilhrllqd