PDB entry 5i4j

View 5i4j on RCSB PDB site
Description: Dps4 from Nostoc punctiforme in complex with Zn ions
Class: metal binding protein
Keywords: Metal binding protein, ferritin like
Deposited on 2016-02-12, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin, Dps family protein
    Species: NOSTOC PUNCTIFORME [TaxId:272131]
    Gene: Npun_R5799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i4ja_
  • Chain 'B':
    Compound: Ferritin, Dps family protein
    Species: NOSTOC PUNCTIFORME [TaxId:272131]
    Gene: Npun_R5799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i4jb_
  • Chain 'C':
    Compound: Ferritin, Dps family protein
    Species: NOSTOC PUNCTIFORME [TaxId:272131]
    Gene: Npun_R5799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i4jc_
  • Chain 'D':
    Compound: Ferritin, Dps family protein
    Species: NOSTOC PUNCTIFORME [TaxId:272131]
    Gene: Npun_R5799
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i4jd_
  • Heterogens: ZN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i4jA (A:)
    tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
    fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
    qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i4jB (B:)
    tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
    fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
    qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i4jC (C:)
    tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
    fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
    qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i4jD (D:)
    tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
    fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
    qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa