PDB entry 5i4c

View 5i4c on RCSB PDB site
Description: Crystal structure of non-phosphorylated receiver domain of the stress response regulator RcsB from Escherichia coli
Class: gene regulation
Keywords: Rcs phosphorelay, DNA-binding, transcriptional regulator, rprA, Structural Genomics, CSGID, Center for Structural Genomics of Infectious Diseases, HYDROLASE, GENE REGULATION
Deposited on 2016-02-11, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein RcsB
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: rcsB, b2217, JW2205
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i4ca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i4cA (A:)
    mnnmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmp
    gdkygdgitlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkal
    aalqkgkkftpesvsrllekisaggyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i4cA (A:)
    nnmnviiaddhpivlfgirksleqiewvnvvgefedstalinnlpkldahvlitdlsmpg
    dkygdgitlikyikrhfpslsiivltmnnnpailsavldldiegivlkqgaptdlpkala
    alqkgkkftpe