PDB entry 5i40

View 5i40 on RCSB PDB site
Description: BRD9 in complex with Cpd1 (6-methyl-1,6-dihydro-7H-pyrrolo[2,3-c]pyridin-7-one)
Class: RNA binding protein
Keywords: Bromodomain Inhibitor Epigenetics Structure-based drug design, RNA BINDING PROTEIN
Deposited on 2016-02-11, released 2016-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD9, UNQ3040/PRO9856
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5i40a_
  • Heterogens: EDO, PEG, 67N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5i40A (A:)
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmsk