PDB entry 5i38

View 5i38 on RCSB PDB site
Description: Crystal Structure of tyrosinase from Bacillus megaterium with inhibitor kojic acid in the active site
Class: oxidoreductase
Keywords: di-copper oxidase, OXIDOREDUCTASE
Deposited on 2016-02-10, released 2016-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5i38a_
  • Chain 'B':
    Compound: tyrosinase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5i38b_
  • Heterogens: CU, KOJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i38A (A:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i38A (A:)
    yrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmssa
    flpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikdf
    ivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwdm
    tsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqii
    hrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5i38B (B:)
    kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
    aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
    fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
    mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
    ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel