PDB entry 5i33

View 5i33 on RCSB PDB site
Description: Unligated adenylosuccinate synthetase from Cryptococcus neoformans
Class: ligase
Keywords: dimer, adenylosuccinate synthetase, purine metabolism, LIGASE
Deposited on 2016-02-09, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylosuccinate synthetase
    Species: Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) [TaxId:235443]
    Gene: CNAG_02858
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i33a_
  • Chain 'B':
    Compound: adenylosuccinate synthetase
    Species: Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) [TaxId:235443]
    Gene: CNAG_02858
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5i33b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i33A (A:)
    rgshhhhhhgsmapspegvtvvlgaqwgdegkgklvdilaaeadicarcaggnnaghtiv
    vrndkgektsyafnllpsglinpectafigsgvvvhvpslfneldtlerkglkvagrllv
    sdrahlvmgfhqivdglkevelggssigttrkgigpaysskasrsglrvhhlfdptfpak
    frklvegrfkryghfefdtegeiemylafaerlrpfivdgptfmhnalssgkrvlvegan
    almldldygtypfvtssstsiggvvsglgispfaikrvvgvikayttrvgggpfptedla
    tvgetlqevgaeygtvtgrrrrcgwldlvvmkystmingytslnltkldvldgfeeikva
    tgykidgvevegfpadldrlakvevqyatlpgwktdisncktyeefpenakayikfiedy
    lgvkvqyvgvgpgrdqnviif
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i33A (A:)
    pegvtvvlgaqwgdegkgklvdilaaeadicarcaggnnaghtivvrektsyafnllpsg
    linpectafigsgvvvhvpslfneldtlerkglkvagrllvsdrahlvmgfhqikgigpa
    ysskasrsglrvhhlfdptfpakfriemylafaerlrpfivdgptfmhnalssgkrvlve
    ganalmldldygtypfvtssstsiggvvsglgispfaikrvvgvikayttrvgggpfpte
    dlatvgetlqevgaeygtvtgrrrrcgwldlvvmkystmingytslnltkldvldgfeei
    kvatgykidgvevegfpadldrlakvevqyatlpgwktdisncktyeefpenakayikfi
    edylgvkvqyvgvgpgrdqnviif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i33B (B:)
    rgshhhhhhgsmapspegvtvvlgaqwgdegkgklvdilaaeadicarcaggnnaghtiv
    vrndkgektsyafnllpsglinpectafigsgvvvhvpslfneldtlerkglkvagrllv
    sdrahlvmgfhqivdglkevelggssigttrkgigpaysskasrsglrvhhlfdptfpak
    frklvegrfkryghfefdtegeiemylafaerlrpfivdgptfmhnalssgkrvlvegan
    almldldygtypfvtssstsiggvvsglgispfaikrvvgvikayttrvgggpfptedla
    tvgetlqevgaeygtvtgrrrrcgwldlvvmkystmingytslnltkldvldgfeeikva
    tgykidgvevegfpadldrlakvevqyatlpgwktdisncktyeefpenakayikfiedy
    lgvkvqyvgvgpgrdqnviif
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i33B (B:)
    pegvtvvlgaqwgdegkgklvdilaaeadicarcaggnnaghtivvrtsyafnllpsgli
    npectafigsgvvvhvpslfneldtlerkglkvagrllvsdrahlvmgfhqikgigpays
    skasrsglrvhhlfdptfpakfrklmylafaerlrpfivdgptfmhnalssgkrvlvega
    nalmldldygtypfvtssstsiggvvsglgispfaikrvvgvikayttrvgggpfptedl
    atvgetlqevgaeyggrrrrcgwldlvvmkystmingytslnltkldvldgfeeikvatg
    ykidgvevegfpadldrlakvevqyatlpgwktdisncktyeefpenakayikfiedylg
    vkvqyvgvgpgrdqnviif