PDB entry 5i2u

View 5i2u on RCSB PDB site
Description: Crystal structure of a novel Halo-Tolerant Cellulase from Soil Metagenome
Class: hydrolase
Keywords: cellulase, halo-tolerant, tim barrel, gh5 family, hydrolase
Deposited on 2016-02-09, released 2017-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: soil metagenome [TaxId:410658]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I2U
    Domains in SCOPe 2.06: d5i2ua_
  • Chain 'B':
    Compound: cellulase
    Species: soil metagenome [TaxId:410658]
    Database cross-references and differences (RAF-indexed):
    • PDB 5I2U
    Domains in SCOPe 2.06: d5i2ub_
  • Heterogens: GOL, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i2uA (A:)
    mgsshhhhhhssglvprgshmennrktdyrsivaqngrlqvigtqlsnekgepvvlrgas
    lgwhnlwprfynknavqwladdwkctvvraamgleiednyrenpefalqcitpviesaie
    ngiyviidfhahnkyteeaktffagmaekygeypnviyeiwnepdyfeweevktyseevi
    aviraidpdniilvgsphwdqdlhlvaedpirdvsnimytmhfyaatheawlrdrtdeai
    akgipvfvsecggseangdgrlgieewktyvdwmesrkiswvawsvsdknetcsmllpra
    sadgnwtedllkpwgkltrnsirnandenpdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i2uA (A:)
    sivaqngrlqvigtqlsnekgepvvlrgaslgwhnlwprfynknavqwladdwkctvvra
    amgleiednyrenpefalqcitpviesaiengiyviidfhahnkyteeaktffagmaeky
    geypnviyeiwnepdyfeweevktyseeviaviraidpdniilvgsphwdqdlhlvaedp
    irdvsnimytmhfyaatheawlrdrtdeaiakgipvfvsecggseangdgrlgieewkty
    vdwmesrkiswvawsvsdknetcsmllprasadgnwtedllkpwgkltrnsirnan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i2uB (B:)
    mgsshhhhhhssglvprgshmennrktdyrsivaqngrlqvigtqlsnekgepvvlrgas
    lgwhnlwprfynknavqwladdwkctvvraamgleiednyrenpefalqcitpviesaie
    ngiyviidfhahnkyteeaktffagmaekygeypnviyeiwnepdyfeweevktyseevi
    aviraidpdniilvgsphwdqdlhlvaedpirdvsnimytmhfyaatheawlrdrtdeai
    akgipvfvsecggseangdgrlgieewktyvdwmesrkiswvawsvsdknetcsmllpra
    sadgnwtedllkpwgkltrnsirnandenpdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i2uB (B:)
    rsivaqngrlqvigtqlsnekgepvvlrgaslgwhnlwprfynknavqwladdwkctvvr
    aamgleiednyrenpefalqcitpviesaiengiyviidfhahnkyteeaktffagmaek
    ygeypnviyeiwnepdyfeweevktyseeviaviraidpdniilvgsphwdqdlhlvaed
    pirdvsnimytmhfyaatheawlrdrtdeaiakgipvfvsecggseangdgrlgieewkt
    yvdwmesrkiswvawsvsdknetcsmllprasadgnwtedllkpwgkltrnsirnan