PDB entry 5i21

View 5i21 on RCSB PDB site
Description: Y55W Hfq from Pseudomonas aeruginosa
Class: RNA binding protein
Keywords: Hfq, Pseudomonas aeruginosa, RNA binding protein
Deposited on 2016-02-08, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: hfq, PSPA7_5673
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6VD57
      • engineered mutation (54)
    Domains in SCOPe 2.07: d5i21a_
  • Chain 'B':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: hfq, PSPA7_5673
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6VD57
      • engineered mutation (54)
    Domains in SCOPe 2.07: d5i21b_
  • Chain 'C':
    Compound: RNA-binding protein Hfq
    Species: Pseudomonas aeruginosa (strain PA7) [TaxId:381754]
    Gene: hfq, PSPA7_5673
    Database cross-references and differences (RAF-indexed):
    • Uniprot A6VD57
      • engineered mutation (54)
    Domains in SCOPe 2.07: d5i21c_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i21A (A:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvwkhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i21A (A:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvwkhaistvvps
    rpvrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i21B (B:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvwkhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i21B (B:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvwkhaistvvps
    rpvrlp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5i21C (C:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvwkhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i21C (C:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvwkhaistvvps
    rpvrl