PDB entry 5i1u

View 5i1u on RCSB PDB site
Description: Crystal structure of germacradien-4-ol synthase from Streptomyces citricolor
Class: lyase
Keywords: Lyase, sesquiterpene cyclase
Deposited on 2016-02-06, released 2016-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Germacradien-4-ol synthase
    Species: Streptomyces citricolor [TaxId:212427]
    Gene: SC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot G5EKM9 (19-End)
      • engineered mutation (266)
    Domains in SCOPe 2.06: d5i1ua_
  • Chain 'B':
    Compound: Germacradien-4-ol synthase
    Species: Streptomyces citricolor [TaxId:212427]
    Gene: SC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot G5EKM9
      • engineered mutation (266)
    Domains in SCOPe 2.06: d5i1ub_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i1uA (A:)
    mgsshhhhhhssglvprgsmsddtslelpfthrrnphqteaadrhlewlqrhrelaavvs
    gstytgwditelaslvypessaedlalaadlmgfyflfddqfdsplgrrpeqvalicerl
    saiahgtltavtspserafadlwrritlgmtdrwraraacnweyyfachpaeaagrtigq
    ppdregyltlrrgtaamesifdmierlghfevpqhvmhhplfrqlrqlaadipsftndvr
    sfaqesergdvanlvmivrrdrccstaeacavvwdeaqrmadrfcdlrdqlpdacrsmsl
    dpaqrlaaeryadgmalwlagylhweshtrryhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i1uA (A:)
    msddtslelpfthrrnphqteaadrhlewlqrhrelaavvsgstytgwditelaslvype
    ssaedlalaadlmgfyflfddqfdsplgrrpeqvalicerlsaiahgtltavtspseraf
    adlwrritlgmtdrwraraacnweyyfachpaeaagrppdregyltlrrgtaamesifdm
    ierlghfevpqhvmhhplfrqlrqlaadipsftndvrsfaqeanlvmivrrdrccstaea
    cavvwdeaqrmadrfcdlrdqlpdacrsmsldpaqrlaaeryadgmalwlagylhwesht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5i1uB (B:)
    mgsshhhhhhssglvprgsmsddtslelpfthrrnphqteaadrhlewlqrhrelaavvs
    gstytgwditelaslvypessaedlalaadlmgfyflfddqfdsplgrrpeqvalicerl
    saiahgtltavtspserafadlwrritlgmtdrwraraacnweyyfachpaeaagrtigq
    ppdregyltlrrgtaamesifdmierlghfevpqhvmhhplfrqlrqlaadipsftndvr
    sfaqesergdvanlvmivrrdrccstaeacavvwdeaqrmadrfcdlrdqlpdacrsmsl
    dpaqrlaaeryadgmalwlagylhweshtrryhhg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i1uB (B:)
    slelpfthrrnphqteaadrhlewlqrhrelaavvsgstytgwditelaslvypessaed
    lalaadlmgfyflfddqfdsplgrrpeqvalicerlsaiahgtltavtspserafadlwr
    ritlgmtdrwraraacnweyyfachpaeaagrtippdregyltlrrgtaamesifdmier
    lghfevpqhvmhhplfrqlrqlaadipsftndvrsfvanlvmivrrdrccstaeacavvw
    deaqrmadrfcdlrdqlpdacrsmsldpaqrlaaeryadgmalwlagylhwesh