PDB entry 5i1a

View 5i1a on RCSB PDB site
Description: crystal structure of human germline antibody ighv3-23/igkv3-11
Class: immune system
Keywords: monoclonal antibody, immune system
Deposited on 2016-02-05, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cnto388 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5I1A (0-End)
    Domains in SCOPe 2.07: d5i1aa1, d5i1aa2
  • Chain 'B':
    Compound: cnto388 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5I1A (0-End)
  • Chain 'H':
    Compound: cnto388 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5I1A (0-End)
  • Chain 'L':
    Compound: cnto388 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5I1A (0-End)
    Domains in SCOPe 2.07: d5i1al1, d5i1al2
  • Heterogens: ACT, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5i1aA (A:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i1aA (A:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5i1aL (L:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5i1aL (L:)
    eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
    rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg