PDB entry 5hzu

View 5hzu on RCSB PDB site
Description: Crystal structure of Dronpa-Ni2+
Class: luminescent protein
Keywords: Fluorescent Protein, LUMINESCENT PROTEIN
Deposited on 2016-02-03, released 2017-03-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzua_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-216)
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzub_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzuc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzud_
  • Chain 'E':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (Start-216)
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzue_
  • Chain 'F':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-End)
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzuf_
  • Chain 'G':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzug_
  • Chain 'H':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (Start-216)
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzuh_
  • Chain 'I':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzui_
  • Chain 'J':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (0-End)
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzuj_
  • Chain 'K':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzuk_
  • Chain 'L':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (Start-216)
      • chromophore (60)
    Domains in SCOPe 2.06: d5hzul_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hzuA (A:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuA (A:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hzuB (B:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hzuC (C:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuC (C:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hzuD (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuD (D:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hzuE (E:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuE (E:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hzuF (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuF (F:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5hzuG (G:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuG (G:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5hzuH (H:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuH (H:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5hzuI (I:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuI (I:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5hzuJ (J:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuJ (J:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5hzuK (K:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuK (K:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5hzuL (L:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    sygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzuL (L:)
    vikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvfs
    ygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfdg
    vnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakkv
    vqlpdyhfvdhhieikshdkdysnvnlhehaeahse