PDB entry 5hzf

View 5hzf on RCSB PDB site
Description: Single Chain Recombinant Globular Head of the Complement System Protein C1q in complex with magnesium
Class: signaling protein
Keywords: gC1q domain, complement, C1q, signaling protein
Deposited on 2016-02-02, released 2016-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit C,Complement C1q subcomponent subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02745 (Start-135)
    • Uniprot P02747 (139-269)
      • linker (270-272)
    • Uniprot P02746 (273-End)
    Domains in SCOPe 2.07: d5hzfa1, d5hzfa2, d5hzfa3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hzfA (A:)
    kdqprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqw
    eiclsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqg
    seadsvfsgflifpsagsgkqkfqsvftvtrqthqppapnslirfnavltnpqgdydtst
    gkftckvpglyyfvyhashtanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvge
    evwlavndyydmvgiqgsdsvfsgfllfpdgsakatqkiafsatrtinvplrrdqtirfd
    hvitnmnnnyeprsgkftckvpglyyftyhassrgnlcvnlmrgreraqkvvtfcdyayn
    tfqvttggmvlkleqgenvflqatdknsllgmegansifsgfllfpdmea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzfA (A:)
    qprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwei
    clsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgse
    adsvfsgflifpsakqkfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftc
    kvpglyyfvyhashtanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwla
    vndyydmvgiqgsdsvfsgfllfpdgsakatqkiafsatrtinvplrrdqtirfdhvitn
    mnnnyeprsgkftckvpglyyftyhassrgnlcvnlmrgreraqkvvtfcdyayntfqvt
    tggmvlkleqgenvflqatdknsllgmegansifsgfllfpd