PDB entry 5hz9

View 5hz9 on RCSB PDB site
Description: human FABP3 in complex with 6-Chloro-2-methyl-4-phenyl-quinoline-3-carboxylic acid
Class: lipid binding protein
Keywords: lipid binding protein, fatty acid binding protein, cytoplasm, lipid-binding, transport, protein binding, _phenix
Deposited on 2016-02-02, released 2016-12-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (2-134)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5hz9a1, d5hz9a2
  • Chain 'B':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (2-134)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5hz9b1, d5hz9b2
  • Chain 'C':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (2-134)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5hz9c1, d5hz9c2
  • Chain 'D':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (2-134)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5hz9d1, d5hz9d2
  • Chain 'E':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (2-134)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5hz9e1, d5hz9e2
  • Chain 'F':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (2-134)
      • expression tag (1)
    Domains in SCOPe 2.06: d5hz9f1, d5hz9f2
  • Chain 'G':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (2-134)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5hz9g1, d5hz9g2
  • Chain 'H':
    Compound: Fatty acid-binding protein, heart
    Species: Homo sapiens [TaxId:9606]
    Gene: FABP3, FABP11, MDGI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05413 (2-134)
      • expression tag (0-1)
    Domains in SCOPe 2.06: d5hz9h1, d5hz9h2
  • Heterogens: SO4, 5M8, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hz9A (A:)
    shmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstf
    knteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltl
    thgtavctrtyekea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hz9B (B:)
    shmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstf
    knteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltl
    thgtavctrtyekea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hz9C (C:)
    shmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstf
    knteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltl
    thgtavctrtyekea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hz9D (D:)
    shmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstf
    knteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltl
    thgtavctrtyekea
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hz9E (E:)
    shmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstf
    knteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltl
    thgtavctrtyekea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hz9F (F:)
    shmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstf
    knteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltl
    thgtavctrtyekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hz9F (F:)
    hmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfk
    nteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlt
    hgtavctrtyekea
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hz9G (G:)
    shmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstf
    knteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltl
    thgtavctrtyekea
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5hz9H (H:)
    shmvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstf
    knteisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltl
    thgtavctrtyekea