PDB entry 5hy9

View 5hy9 on RCSB PDB site
Description: Glycosylated, disulfide-linked Knob-into-Hole Fc fragment
Class: immune system
Keywords: Bispecific antibody Fc engineering Knob-into-Hole, Immune System
Deposited on 2016-02-01, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (133)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d5hy9a1, d5hy9a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (128)
      • engineered mutation (145)
      • engineered mutation (147)
      • engineered mutation (186)
    Domains in SCOPe 2.07: d5hy9b1, d5hy9b2
  • Heterogens: NAG, BMA, GAL, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hy9A (A:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppcrdeltknqvslwclvkgfypsdiavewesngqpennykttppvlds
    dgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hy9A (A:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppcrd
    eltknqvslwclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hy9B (B:)
    dkthtcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvctlppsrdeltknqvslscavkgfypsdiavewesngqpennykttppvlds
    dgsfflvskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hy9B (B:)
    svflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpnstyrvv
    svltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvctlppsrdeltknqv
    slscavkgfypsdiavewesngqpennykttppvldsdgsfflvskltvdksrwqqgnvf
    scsvmhealhnhytqkslsl