PDB entry 5hum

View 5hum on RCSB PDB site
Description: The crystal structure of neuraminidase from A/Sichuan/26221/2014 influenza virus
Class: viral protein
Keywords: neuraminidase, influenza virus, H5Nx, VIRAL PROTEIN
Deposited on 2016-01-27, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (A/chicken/Sichuan/NCJPL1/2014(H5N6)) [TaxId:1529593]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HUM (Start-390)
    Domains in SCOPe 2.07: d5huma_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus (A/chicken/Sichuan/NCJPL1/2014(H5N6)) [TaxId:1529593]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HUM (Start-390)
    Domains in SCOPe 2.07: d5humb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus (A/chicken/Sichuan/NCJPL1/2014(H5N6)) [TaxId:1529593]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HUM (Start-390)
    Domains in SCOPe 2.07: d5humc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus (A/chicken/Sichuan/NCJPL1/2014(H5N6)) [TaxId:1529593]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HUM (Start-390)
    Domains in SCOPe 2.07: d5humd_
  • Heterogens: CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5humA (A:)
    pgghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgtt
    lrgkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpn
    nnasavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfk
    egkikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylc
    skiltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlk
    vpnaetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvl
    wtsnsivalcgskerlgswswhdgaeiiyfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5humA (A:)
    ghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgttlr
    gkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpnnn
    asavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfkeg
    kikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylcsk
    iltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskerlgswswhdgaeiiyfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5humB (B:)
    pgghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgtt
    lrgkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpn
    nnasavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfk
    egkikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylc
    skiltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlk
    vpnaetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvl
    wtsnsivalcgskerlgswswhdgaeiiyfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5humB (B:)
    ghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgttlr
    gkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpnnn
    asavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfkeg
    kikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylcsk
    iltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskerlgswswhdgaeiiyfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5humC (C:)
    pgghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgtt
    lrgkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpn
    nnasavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfk
    egkikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylc
    skiltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlk
    vpnaetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvl
    wtsnsivalcgskerlgswswhdgaeiiyfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5humC (C:)
    ghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgttlr
    gkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpnnn
    asavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfkeg
    kikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylcsk
    iltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskerlgswswhdgaeiiyfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5humD (D:)
    pgghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgtt
    lrgkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpn
    nnasavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfk
    egkikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylc
    skiltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlk
    vpnaetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvl
    wtsnsivalcgskerlgswswhdgaeiiyfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5humD (D:)
    ghllnltkplcevnswhilskdnairigedahiivtrepylscdpqgcrmfalsqgttlr
    gkhangtihdrspfralvswemgqapspyntrvecigwsstschdgisrmsicisgpnnn
    asavvwyggrpvteipswagnilrtqesecvchggicpvvmtdgpannraetkiiyfkeg
    kikkieelkgdaqhieecscygasemikcicrdnwkganrpvitidpemmthtskylcsk
    iltdtsrpndptngkceapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdtqsgaishqiivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskerlgswswhdgaeiiyfk