PDB entry 5hue

View 5hue on RCSB PDB site
Description: DAHP synthase from Corynebacterium glutamicum in complex with tryptophan
Class: sugar binding protein
Keywords: DAHP synthase, shikimate pathway, sugar binding protein
Deposited on 2016-01-27, released 2017-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-Deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase
    Species: Corynebacterium glutamicum [TaxId:1718]
    Gene: Cgl2178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5huea_
  • Heterogens: MN, PEP, TRP, MPD, PGE, PO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hueA (A:)
    mhhhhhhssgmswtvdipkevlpdlpplpegmqqqfedtisrdakqqptwdraqaenvrk
    ilesvppivvapevlelkqkladvangkafllqggdcaetfesntephiranvktllqma
    vvltygastpvikmariagqyakprssdldgnglpnyrgdivngveatpearrhdparmi
    rayanasaamnlvraltssgtadlyrlsewnrefvanspagaryealareidsglrfmea
    cgvsdeslraadiycsheallvdyersmlrlatdeegneelydlsahqlwigertrgmdd
    fhvnfasmisnpigikigpgitpeeavayadkldpnfepgrltivarmghdkvrsvlpgv
    iqaveasghkviwqsdpmhgntftasngyktrhfdkvidevqgffevhralgthpggihi
    eftgedvteclggaeditdvdlpgryesacdprlntqqslelaflvaemlrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hueA (A:)
    pplpegmqqqfedtisrdakqqptwdraqaenvrkilesvppivvapevlelkqkladva
    ngkafllqggdcaetfesntephiranvktllqmavvltygastpvikmariagqyakpr
    ssdldgnglpnyrgdivngveatpearrhdparmirayanasaamnlvraltssgtadly
    rlsewnrefvanspagaryealareidsglrfmeacgvsdeslraadiycsheallvdye
    rsmlrlatdeegneelydlsahqlwigertrgmddfhvnfasmisnpigikigpgitpee
    avayadkldpnfepgrltivarmghdkvrsvlpgviqaveasghkviwqsdpmhgntfta
    sngyktrhfdkvidevqgffevhralgthpggihieftgedvteclggaeditdvdlpgr
    yesacdprlntqqslelaflvaemlrn