PDB entry 5hsh

View 5hsh on RCSB PDB site
Description: Crystal structure of the G291R mutant of human phosphoglucomutase 1
Class: isomerase
Keywords: phosphoglucomutase, isomerase, enzyme, missense mutant
Deposited on 2016-01-25, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (0-561)
      • engineered mutation (290)
    Domains in SCOPe 2.07: d5hsha1, d5hsha2, d5hsha3, d5hsha4
  • Chain 'B':
    Compound: Phosphoglucomutase-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36871 (0-561)
      • engineered mutation (290)
    Domains in SCOPe 2.07: d5hshb1, d5hshb2, d5hshb3, d5hshb4
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hshA (A:)
    mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
    gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
    ggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
    fkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilcee
    lgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdrdrnmilgkh
    gffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwk
    ffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqky
    grnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpv
    dgsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlapli
    sialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hshA (A:)
    mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
    gdgymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltadfgikf
    nisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenkfkpftveivds
    veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
    vpleyaadlvetmksgehdfgaafdgdrdrnmilgkhgffvnpsdsvaviaanifsipyf
    qqtgvrgfarsmptsgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgs
    dhirekdglwavlawlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmk
    dlealmfdrsfvgkqfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfr
    lsagatirlyidsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hshB (B:)
    mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
    gdgrfymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltashnp
    ggpngdfgikfnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenk
    fkpftveivdsveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilcee
    lgapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdrdrnmilgkh
    gffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwk
    ffgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqky
    grnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpv
    dgsisrnqglrliftdgsrivfrlsgtgsagatirlyidsyekdvakinqdpqvmlapli
    sialkvsqlqertgrtaptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hshB (B:)
    mvkivtvktqayqdqkpgtsglrkrvkvfqssanyaenfiqsiistvepaqrqeatlvvg
    gdgymkeaiqliariaaangigrlvigqngilstpavsciirkikaiggiiltasdfgik
    fnisnggpapeaitdkifqisktieeyavcpdlkvdlgvlgkqqfdlenkfkpftveivd
    sveayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavn
    cvaadlvetmksgehdfgaafdgdrdrnmilgkhgffvnpsdsvaviaanifsipyfqqt
    gvrgfarsmptsgaldrvasatkialyetptgwkffgnlmdasklslcgeesfgtgsdhi
    rekdglwavlawlsilatrkqsvedilkdhwqkygrnfftrydyeeveaegankmmkdle
    almfdrsfvgkqfsandkvytvekadnfeysdpvdgsisrnqglrliftdgsrivfrlti
    rlyidsyekdvakinqdpqvmlaplisialkvsqlqertgrtaptvit