PDB entry 5hs9

View 5hs9 on RCSB PDB site
Description: Crystal structure of the quinone-bound YodB from B. subtilis
Class: DNA binding protein
Keywords: HTH-type transcriptional regulator, oxidized form, DNA BINDING PROTEIN
Deposited on 2016-01-25, released 2016-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-17, with a file datestamp of 2016-08-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator YodB
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: yodB, BSU19540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hs9a_
  • Chain 'B':
    Compound: HTH-type transcriptional regulator YodB
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: yodB, BSU19540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hs9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hs9A (A:)
    hmmcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqnei
    verqvlpetpvkviytltekgtalqavfqemqawadqfcepgdtvceeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hs9A (A:)
    cpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneiver
    qvviytltekgtalqavfqemqawadqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hs9B (B:)
    hmmcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqnei
    verqvlpetpvkviytltekgtalqavfqemqawadqfcepgdtvceeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hs9B (B:)
    mcpkmesafsllgkrwngliihvlmdgpkrfkeitetipmisqkmlaerlkeleqneive
    rqvlviytltekgtalqavfqemqawadqf