PDB entry 5hr3

View 5hr3 on RCSB PDB site
Description: Crystal structure of thioredoxin N106A mutant
Class: oxidoreductase
Keywords: thioredoxin, thiol redox-reactions, OXIDOREDUCTASE
Deposited on 2016-01-22, released 2017-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, BN17_37301, ECs4714
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3SKR2 (Start-108)
      • engineered mutation (106)
    Domains in SCOPe 2.06: d5hr3a_
  • Chain 'B':
    Compound: thioredoxin
    Species: Escherichia coli [TaxId:562]
    Gene: trxA, BN17_37301, ECs4714
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3SKR2 (Start-108)
      • engineered mutation (106)
    Domains in SCOPe 2.06: d5hr3b_
  • Heterogens: CU, EOH, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hr3A (A:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hr3A (A:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldaala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hr3B (B:)
    msdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvakln
    idqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hr3B (B:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldaala