PDB entry 5hql

View 5hql on RCSB PDB site
Description: Structure function studies of R. palustris RubisCO (A47V-M331A mutant; CABP-bound; no expression tag)
Class: lyase
Keywords: RubisCO, hexamer, LYASE
Deposited on 2016-01-21, released 2017-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (0-End)
      • engineered mutation (46)
      • engineered mutation (330)
    Domains in SCOPe 2.06: d5hqla1, d5hqla2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (0-End)
      • engineered mutation (46)
      • engineered mutation (330)
    Domains in SCOPe 2.06: d5hqlb1, d5hqlb2
  • Chain 'C':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (0-End)
      • engineered mutation (46)
      • engineered mutation (330)
    Domains in SCOPe 2.06: d5hqlc1, d5hqlc2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (0-End)
      • engineered mutation (46)
      • engineered mutation (330)
    Domains in SCOPe 2.06: d5hqld1, d5hqld2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (0-End)
      • engineered mutation (46)
      • engineered mutation (330)
    Domains in SCOPe 2.06: d5hqle1, d5hqle2
  • Chain 'F':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (0-End)
      • engineered mutation (46)
      • engineered mutation (330)
    Domains in SCOPe 2.06: d5hqlf1, d5hqlf2
  • Heterogens: CAP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hqlA (A:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklkpqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqlA (A:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrakl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hqlB (B:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklkpqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqlB (B:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hqlC (C:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklkpqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqlC (C:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrakl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hqlD (D:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklkpqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqlD (D:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hqlE (E:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklkpqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqlE (E:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hqlF (F:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklkpqaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hqlF (F:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefadhrefarafesfpqdadklypnwrak