PDB entry 5hpt

View 5hpt on RCSB PDB site
Description: System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: WWP1, Ubv P2.3 and UBCH7
Class: ligase/transferase
Keywords: HECT E3, WWP1, Ubiquitin, Ubv, UBCH7, LIGASE-TRANSFERASE complex
Deposited on 2016-01-20, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD4-like E3 ubiquitin-protein ligase WWP1
    Species: Homo sapiens [TaxId:9606]
    Gene: WWP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hpta_
  • Chain 'B':
    Compound: Ubiquitin variant P2.3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPT
    Domains in SCOPe 2.07: d5hptb_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 L3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2L3, UBCE7, UBCH7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hptc_
  • Chain 'D':
    Compound: NEDD4-like E3 ubiquitin-protein ligase WWP1
    Species: Homo sapiens [TaxId:9606]
    Gene: WWP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hptd_
  • Chain 'E':
    Compound: Ubiquitin variant P2.3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPT
    Domains in SCOPe 2.07: d5hpte_
  • Chain 'F':
    Compound: Ubiquitin-conjugating enzyme E2 L3
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2L3, UBCE7, UBCH7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hptf_
  • Chain 'G':
    Compound: NEDD4-like E3 ubiquitin-protein ligase WWP1
    Species: Homo sapiens [TaxId:9606]
    Gene: WWP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hptg_
  • Chain 'H':
    Compound: Ubiquitin variant P2.3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPT
    Domains in SCOPe 2.07: d5hpth_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hptA (A:)
    gsggpqiayergfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrr
    rlyvifrgeegldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhl
    syfcfigrfiamalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnn
    ieecglemyfsvdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtk
    afldgfnevvplqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqf
    vketdnevrmrllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrl
    dlppyksyeqlkekllfaieete
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hptA (A:)
    rgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrgee
    gldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrfi
    amalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemyf
    svdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnevv
    plqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevrm
    rllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksyeq
    lkekllfaieete
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hptB (B:)
    gsggsmqilvktftwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdynikmgsslylvlrlpgqri
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hptB (B:)
    mqilvktftwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    ikmgsslylvlrlpgq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hptC (C:)
    aasrrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaey
    pfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehpl
    radlaeeyskdrkkfcknaeeftkkygekrpvdgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hptC (C:)
    aasrrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaey
    pfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehpl
    radlaeeyskdrkkfcknaeeftkkygekrp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hptD (D:)
    gsggpqiayergfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrr
    rlyvifrgeegldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhl
    syfcfigrfiamalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnn
    ieecglemyfsvdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtk
    afldgfnevvplqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqf
    vketdnevrmrllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrl
    dlppyksyeqlkekllfaieete
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hptD (D:)
    rgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrgee
    gldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrfi
    amalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemyf
    svdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnevv
    plqwlqyfdekelevmlcgmevdladwqrntvyrhtrnskqiiwfwqfvketdnevrmrl
    lqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksyeqlk
    ekllfaieete
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hptE (E:)
    gsggsmqilvktftwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdynikmgsslylvlrlpgqri
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hptE (E:)
    mqilvktftwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    ikmgsslylvlrlpgq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hptF (F:)
    aasrrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaey
    pfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehpl
    radlaeeyskdrkkfcknaeeftkkygekrpvdgghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hptF (F:)
    aasrrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaey
    pfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehpl
    radlaeeyskdrkkfcknaeeftkkygekr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5hptG (G:)
    gsggpqiayergfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrr
    rlyvifrgeegldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhl
    syfcfigrfiamalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnn
    ieecglemyfsvdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtk
    afldgfnevvplqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqf
    vketdnevrmrllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrl
    dlppyksyeqlkekllfaieete
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hptG (G:)
    gfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrgeeg
    yglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrfiamal
    fhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemyfsvdm
    eilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnevvplqw
    lqyfdekelevmlcgmqevdladwqrntvyrtrnskqiiwfwqfvketdnevrmrllqfv
    tgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksyeqlkekll
    faieete
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5hptH (H:)
    gsggsmqilvktftwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
    lsdynikmgsslylvlrlpgqri
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hptH (H:)
    mqilvktftwktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    ikmgsslylvlrlpg