PDB entry 5hps

View 5hps on RCSB PDB site
Description: System-wide modulation of HECT E3 ligases with selective ubiquitin variant probes: WWP1 and UbV P1.1
Class: ligase
Keywords: HECT, E3 ligase, Ubiquitin variant, Ubv, LIGASE
Deposited on 2016-01-20, released 2016-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: wwp1 hect
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hpsa_
  • Chain 'B':
    Compound: Ubiquitin variant P1.1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5HPS
    Domains in SCOPe 2.06: d5hpsb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hpsA (A:)
    gsggpqiayergfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrr
    rlyvifrgeegldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhl
    syfcfigrfiamalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnn
    ieecglemyfsvdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtk
    afldgfnevvplqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqf
    vketdnevrmrllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrl
    dlppyksyeqlkekllfaieete
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hpsA (A:)
    iayergfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvif
    rgeeygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrf
    iamalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemy
    fsvdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnev
    vplqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevr
    mrllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksye
    qlkekllfaieete
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hpsB (B:)
    gsggsmhifvktlrgwsitlevepsdtienvkakiqdkegippdqqilifarkkledgrt
    lsdyniqeksslylflrllrksr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hpsB (B:)
    mhifvktlrgwsitlevepsdtienvkakiqdkegippdqqilifarkkledgrtlsdyn
    iqeksslylflrl