PDB entry 5hos

View 5hos on RCSB PDB site
Description: Crystal structure of the endo-beta-1,4-glucanase Xac0029 from Xanthomonas axonopodis pv. citri
Class: hydrolase
Keywords: endo-beta-1, 4-glucanase, HYDROLASE
Deposited on 2016-01-19, released 2017-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: egl, XAC0029
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hosa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hosA (A:)
    mgsshhhhhhssglvprgshmqsatglkyagvnlsgaeikssqkpgvlnidyrypaadey
    ayfagkhmntvrlpilwerlqpraggeldpaqlalirqavanakaakmyvivdvhnyaky
    yghtigstkvpistfndlwrrlaiafksdnavifglmnepydidpqawataaqasidtir
    ktgatnlilvpgalwtgahswystvagqsnavamasirdplnryaieahqyldadssgts
    ggcvsatvgverlrsftewlrlnkkrgflaefgtgntvtcnlalngmlgymesnsdvwmg
    wswwaagawwsgaypfnvqpdaqgrdkpqmsilsprarritd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hosA (A:)
    lkyagvnlsgaeikssqkpgvlnidyrypaadeyayfagkhmntvrlpilwerlqpragg
    eldpaqlalirqavanakaakmyvivdvhnyakyyghtigstkvpistfndlwrrlaiaf
    ksdnavifglmnepydidpqawataaqasidtirktgatnlilvpgalwtgahswystva
    gqsnavamasirdplnryaieahqyldadssgtsggcvsatvgverlrsftewlrlnkkr
    gflaefgtgntvtcnlalngmlgymesnsdvwmgwswwaagawwsgaypfnvqpdaqgrd
    kpqmsilsprarritd