PDB entry 5hnn

View 5hnn on RCSB PDB site
Description: Crystal structure of the endo-beta-1,4-glucanase (Xac0030) from Xanthomonas axonopodis pv. citri with the triple mutation His174Trp, Tyr211Ala and Lys227Arg.
Class: hydrolase
Keywords: Endo-beta-1, 4-glucanase, HYDROLASE
Deposited on 2016-01-18, released 2017-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: egl, XAC0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PRD3 (21-End)
      • expression tag (20)
      • engineered mutation (193)
      • engineered mutation (230)
      • engineered mutation (246)
    Domains in SCOPe 2.06: d5hnna1, d5hnna2
  • Chain 'B':
    Compound: cellulase
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: egl, XAC0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PRD3 (21-End)
      • engineered mutation (193)
      • engineered mutation (230)
      • engineered mutation (246)
    Domains in SCOPe 2.06: d5hnnb_
  • Chain 'C':
    Compound: cellulase
    Species: Xanthomonas axonopodis pv. citri [TaxId:190486]
    Gene: egl, XAC0030
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PRD3 (21-336)
      • expression tag (18-20)
      • engineered mutation (193)
      • engineered mutation (230)
      • engineered mutation (246)
    Domains in SCOPe 2.06: d5hnnc1, d5hnnc2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hnnA (A:)
    mgsshhhhhhssglvprgshmlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfag
    kgmntirlpflwervqpelngpldqaqlglikksleaakankqylildlhnyatysgkri
    gtsdvpagaladlwrrlalefkddkavifglmnepngisapdwanaaqgtitairktgak
    nlilvpgtaytgawswrstsygvsnakaleilkdpgnnlafeahqyldkdasgtkpvcts
    dsvgqerlqgftswlrenkqkgflgefatannpvcdkalegmltymeknsdvwlgwtwwa
    agawwkpdypftvqpgkdgsdkpqmailskyarragk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hnnA (A:)
    mlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpeln
    gpldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlale
    fkddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgawswrsts
    ygvsnakaleilkdpgnnlafeahqyldkdasgtkpvctsdsvgqerlqgftswlrenkq
    kgflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgs
    dkpqmailskyarra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hnnB (B:)
    mgsshhhhhhssglvprgshmlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfag
    kgmntirlpflwervqpelngpldqaqlglikksleaakankqylildlhnyatysgkri
    gtsdvpagaladlwrrlalefkddkavifglmnepngisapdwanaaqgtitairktgak
    nlilvpgtaytgawswrstsygvsnakaleilkdpgnnlafeahqyldkdasgtkpvcts
    dsvgqerlqgftswlrenkqkgflgefatannpvcdkalegmltymeknsdvwlgwtwwa
    agawwkpdypftvqpgkdgsdkpqmailskyarragk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hnnB (B:)
    lkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpelng
    pldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrlalef
    kddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgawswrstsy
    gvsnakaleilkdpgnnlafeahqyldkdasgtkpvctsdsvgqerlqgftswlrenkqk
    gflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkdgsd
    kpqmailskyarra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hnnC (C:)
    mgsshhhhhhssglvprgshmlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfag
    kgmntirlpflwervqpelngpldqaqlglikksleaakankqylildlhnyatysgkri
    gtsdvpagaladlwrrlalefkddkavifglmnepngisapdwanaaqgtitairktgak
    nlilvpgtaytgawswrstsygvsnakaleilkdpgnnlafeahqyldkdasgtkpvcts
    dsvgqerlqgftswlrenkqkgflgefatannpvcdkalegmltymeknsdvwlgwtwwa
    agawwkpdypftvqpgkdgsdkpqmailskyarragk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hnnC (C:)
    shmlkyvgvnlsgaefnsrkkpgtlfkdytypaasdfsyfagkgmntirlpflwervqpe
    lngpldqaqlglikksleaakankqylildlhnyatysgkrigtsdvpagaladlwrrla
    lefkddkavifglmnepngisapdwanaaqgtitairktgaknlilvpgtaytgawswrs
    tsygvsnakaleilkdpgnnlafeahqyldkdasgtkpvctsdsvgqerlqgftswlren
    kqkgflgefatannpvcdkalegmltymeknsdvwlgwtwwaagawwkpdypftvqpgkd
    gsdkpqmailskyarragk