PDB entry 5hm7

View 5hm7 on RCSB PDB site
Description: The Intracellular domain of Butyrophilin 3A1 protein
Class: immune system
Keywords: Immunological protein, intracellular domain, IMMUNE SYSTEM
Deposited on 2016-01-15, released 2017-07-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A1, BTF5
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BTN3A1, BTF5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5hm7b_
  • Heterogens: GOL, BME, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hm7B (B:)
    mgqqqeekktqfrkkkreqelremawstmkqeqstrvklleelrwrsiqyasrgerhsay
    newkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhycvlgces
    fisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrtlteprt
    nlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltleptalt
    icpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hm7B (B:)
    erhsaynewkkalfkpadvildpktanpillvsedqrsvqrakepqdlpdnperfnwhyc
    vlgcesfisgrhywevevgdrkewhigvcsknvqrkgwvkmtpengfwtmgltdgnkyrt
    lteprtnlklpkppkkvgvfldyetgdisfynavdgshihtfldvsfsealypvfriltl
    eptalticpa