PDB entry 5hm6

View 5hm6 on RCSB PDB site
Description: N-terminal domain of BfmR from Acinetobacter baumannii
Class: transcription regulator
Keywords: response regulator, biofilm, two-component system, A. baumannii, TRANSCRIPTION REGULATOR
Deposited on 2016-01-15, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BfmR
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: bfmR, rstA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hm6a_
  • Chain 'B':
    Compound: BfmR
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: bfmR, rstA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hm6b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hm6A (A:)
    gshmsqeeklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvl
    dvmlpgadgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllar
    irallrrtdktve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hm6A (A:)
    klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
    gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hm6B (B:)
    gshmsqeeklpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvl
    dvmlpgadgltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllar
    irallrrtdktve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hm6B (B:)
    klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
    gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrr