PDB entry 5hkj

View 5hkj on RCSB PDB site
Description: Single Chain Recombinant Globular Head of the Complement System Protein C1q
Class: signaling protein
Keywords: gC1q domain, complement, C1q, signaling protein
Deposited on 2016-01-14, released 2016-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1q subcomponent subunit A,Complement C1q subcomponent subunit C,Complement C1q subcomponent subunit B
    Species: Homo sapiens [TaxId:9606]
    Gene: C1QB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02745 (Start-135)
    • Uniprot P02747 (Start-269)
      • linker (270-272)
    • Uniprot P02746 (273-End)
    Domains in SCOPe 2.06: d5hkja1, d5hkja2, d5hkja3
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hkjA (A:)
    kdqprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqw
    eiclsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqg
    seadsvfsgflifpsagsgkqkfqsvftvtrqthqppapnslirfnavltnpqgdydtst
    gkftckvpglyyfvyhashtanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvge
    evwlavndyydmvgiqgsdsvfsgfllfpdgsakatqkiafsatrtinvplrrdqtirfd
    hvitnmnnnyeprsgkftckvpglyyftyhassrgnlcvnlmrgreraqkvvtfcdyayn
    tfqvttggmvlkleqgenvflqatdknsllgmegansifsgfllfpdmea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hkjA (A:)
    dqprpafsairrnppmggnvvifdtvitnqeepyqnhsgrfvctvpgyyyftfqvlsqwe
    iclsivsssrgqvrrslgfcdttnkglfqvvsggmvlqlqqgdqvwvekdpkkghiyqgs
    eadsvfsgflifpsakfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftck
    vpglyyfvyhashtanlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlav
    ndyydmvgiqgsdsvfsgfllfpdgsakatqkiafsatrtinvplrrdqtirfdhvitnm
    nnnyeprsgkftckvpglyyftyhassrgnlcvnlmrgreraqkvvtfcdyayntfqvtt
    ggmvlkleqgenvflqatdknsllgmegansifsgfllfpdm