PDB entry 5hk4

View 5hk4 on RCSB PDB site
Description: Structure function studies of R. palustris RubisCO (A47V-M331A mutant)
Class: lyase
Keywords: RubisCO, hexamer, LYASE
Deposited on 2016-01-13, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (66)
      • engineered mutation (350)
    Domains in SCOPe 2.07: d5hk4a1, d5hk4a2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (66)
      • engineered mutation (350)
    Domains in SCOPe 2.07: d5hk4b1, d5hk4b2
  • Chain 'C':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (66)
      • engineered mutation (350)
    Domains in SCOPe 2.07: d5hk4c1, d5hk4c2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (66)
      • engineered mutation (350)
    Domains in SCOPe 2.07: d5hk4d1, d5hk4d2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (66)
      • engineered mutation (350)
    Domains in SCOPe 2.07: d5hk4e1, d5hk4e2
  • Chain 'F':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (66)
      • engineered mutation (350)
    Domains in SCOPe 2.07: d5hk4f1, d5hk4f2
  • Heterogens: CAP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hk4A (A:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfvaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkaegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk4A (A:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hk4B (B:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfvaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkaegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk4B (B:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hk4C (C:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfvaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkaegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk4C (C:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hk4D (D:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfvaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkaegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk4D (D:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrakl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hk4E (E:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfvaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkaegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk4E (E:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hk4F (F:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfvaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkaegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hk4F (F:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfvaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak