PDB entry 5hjp

View 5hjp on RCSB PDB site
Description: Identification of LXRbeta selective agonists for the treatment of Alzheimer's Disease
Class: signaling protein
Keywords: Agonist, Alzheimer's, SIGNALING PROTEIN
Deposited on 2016-01-13, released 2016-04-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-06, with a file datestamp of 2016-04-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRB, NR2B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28702 (0-End)
      • expression tag (242-249)
  • Chain 'B':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55055 (0-244)
      • engineered mutation (42)
      • engineered mutation (44-45)
      • engineered mutation (47)
      • expression tag (245-260)
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRB, NR2B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28702 (0-End)
      • expression tag (242-249)
  • Chain 'D':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55055 (Start-244)
      • engineered mutation (45)
      • engineered mutation (47)
      • expression tag (245-260)
  • Heterogens: 668, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.06, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5hjpA (A:)
    mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
    hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
    rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
    ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqlagsgsg
    shkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records):
    >5hjpA (A:)
    mpvdrileaelavevtnicqaadkqlftlvewakriphfsslplddqvillragwnelli
    asfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgcl
    raiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsigl
    kclehlfffkligdtpidtflmemleakilhrllq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5hjpB (B:)
    gvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelai
    isvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftys
    kddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealq
    qpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllsei
    wdvhegsgsgshkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records):
    >5hjpB (B:)
    gvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwpadpasgsasqqrfahftelaiis
    vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskd
    dfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqp
    yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    vhegsgsgshkilhrllqd
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5hjpC (C:)
    mpvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlvewakrip
    hfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsagvgaifd
    rvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasletyckqk
    ypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqlagsgsg
    shkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records):
    >5hjpC (C:)
    mpvdrileaelavepvtnicqaadkqlftlvewakriphfsslplddqvillragwnell
    iasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktelgc
    lraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrsig
    lkclehlfffkligdtpidtflmemleakilhrllq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5hjpD (D:)
    gvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpasgsasqqrfahftelai
    isvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftys
    kddfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealq
    qpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllsei
    wdvhegsgsgshkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records):
    >5hjpD (D:)
    qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwpsasqqrfahftelaiisvqeivdfa
    kqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglq
    vefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsy
    trikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdvhegsgsg
    shkilhrllqd