PDB entry 5hgx

View 5hgx on RCSB PDB site
Description: Crystal Structure of Transketolase mutant - H261F from Pichia Stipitis
Class: transferase
Keywords: transketolase, TRANSFERASE
Deposited on 2016-01-09, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Scheffersomyces stipitis CBS 6054 [TaxId:322104]
    Gene: TKT, TKT1, PICST_67105
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34736 (Start-696)
      • engineered mutation (280)
    Domains in SCOPe 2.07: d5hgxa1, d5hgxa2, d5hgxa3
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hgxA (A:)
    mgsshhhhhhssglvprgshmssvdqkaistirllavdavaaansghpgaplglapaaha
    vfkkmrfnpkdtkwinrdrfvlsnghacallysmlvlygydltvedlkkfrqlgsktpgh
    pentdvpgaevttgplgqgicngvgialaqaqfaatynkpdfpisdsytyvflgdgclme
    gvsseasslaghlqlgnliafwddnkisidgstevaftedviaryksygwhivevsdadt
    ditaiaaaideakkvtnkptlvrltttigfgslaqgthgvfgaplkaddikqlktkwgfn
    peesfavpaevtasynehvaenqkiqqqwnelfaaykqkypelgaelqrrldgklpenwd
    kalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdfqpaatg
    lgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsalsefpi
    twvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaiesthtphi
    laltrqnlpqlegssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgika
    gvvslpdqltfdkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkap
    eifklfeftpegvaeraaktvafykgkdvvsplrsaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hgxA (A:)
    ssvdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfv
    lsnghacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgic
    ngvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliaf
    wddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptl
    vrltttigfgslaqgthgvfgaplkaddikqlktkwgfnpeesfavpaevtasynehvae
    nqkiqqqwnelfaaykqkypelgaelqrrldgklpenwdkalpvytpadaavatrklsei
    vlskiipevpeiiggsadltpsnltkakgtvdfqpaatglgdysgryirygvrehamgai
    mngiaafganyknyggtflnfvsyaagavrlsalsefpitwvathdsiglgedgpthqpi
    etlahfratpnisvwrpadgnetsaayksaiesthtphilaltrqnlpqlegssiekask
    ggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltfdkqseeykls
    vlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpegvaeraaktv
    afykgkdvvsplrsaf