PDB entry 5hfm

View 5hfm on RCSB PDB site
Description: Gp41-targeting HIV-1 fusion inhibitors with hook-like Ile-Asp-Leu tail
Class: viral protein
Keywords: HIV-1 fusion inhibitor, Ile-Asp-Leu tail, hook-like tail, VIRAL PROTEIN
Deposited on 2016-01-07, released 2017-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein gp160,gp41 CHR region
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70626 (4-End)
      • expression tag (3)
    • PDB 5HFM (Start-81)
    Domains in SCOPe 2.06: d5hfma1, d5hfma2
  • Chain 'B':
    Compound: Envelope glycoprotein gp160,gp41 CHR region
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70626 (4-End)
      • expression tag (3)
    • PDB 5HFM (Start-81)
    Domains in SCOPe 2.06: d5hfmb1, d5hfmb2
  • Chain 'C':
    Compound: Envelope glycoprotein gp160,gp41 CHR region
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70626 (4-End)
      • expression tag (3)
    • PDB 5HFM (Start-81)
    Domains in SCOPe 2.06: d5hfmc1, d5hfmc2
  • Chain 'D':
    Compound: Envelope glycoprotein gp160,gp41 CHR region
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70626 (4-End)
      • expression tag (3)
    • PDB 5HFM (Start-81)
    Domains in SCOPe 2.06: d5hfmd1, d5hfmd2
  • Chain 'E':
    Compound: Envelope glycoprotein gp160,gp41 CHR region
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70626 (4-End)
      • expression tag (3)
    • PDB 5HFM (Start-81)
    Domains in SCOPe 2.06: d5hfme1, d5hfme2
  • Chain 'F':
    Compound: Envelope glycoprotein gp160,gp41 CHR region
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70626 (4-End)
      • expression tag (3)
    • PDB 5HFM (Start-81)
    Domains in SCOPe 2.06: d5hfmf1, d5hfmf2
  • Heterogens: TAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hfmA (A:)
    gpmavqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkk
    ieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfmA (A:)
    avqarqllsgivqqqnnllraieaqqhllqltvwgikqlqariggrggweewdkkieeyt
    kkieelikksqnqqidl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hfmB (B:)
    gpmavqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkk
    ieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfmB (B:)
    avqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarirggweewdkkieeytkk
    ieelikksqnqqidl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5hfmC (C:)
    gpmavqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkk
    ieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfmC (C:)
    avqarqllsgivqqqnnllraieaqqhllqltvwgikqlqariggrggweewdkkieeyt
    kkieelikksqnqqidl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5hfmD (D:)
    gpmavqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkk
    ieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfmD (D:)
    avqarqllsgivqqqnnllraieaqqhllqltvwgikqlqariggrggweewdkkieeyt
    kkieelikksqnqqidl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5hfmE (E:)
    gpmavqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkk
    ieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfmE (E:)
    avqarqllsgivqqqnnllraieaqqhllqltvwgikqlqariggrggweewdkkieeyt
    kkieelikksqnqqidl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5hfmF (F:)
    gpmavqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkk
    ieeytkkieelikksqnqqidl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hfmF (F:)
    avqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarirggweewdkkieeytkk
    ieelikksqnqqidl